PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.X496W
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 432aa    MW: 47573.3 Da    PI: 10.5786
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.X496WgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.56.4e-13190234347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
      Araip.X496W 190 PWTEEEHRMFLVGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 234
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.2E-43555IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.5153653IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.239183239IPR017930Myb domain
SMARTSM007171.4E-9187237IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-16189240IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-18189238IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.9E-11189233IPR009057Homeodomain-like
PfamPF002491.7E-10190234IPR001005SANT/Myb domain
CDDcd001679.32E-9190235No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
NQSSRNLHLL LLFFFIFFFF LFRVISPSTE SIGMTRRCSH CSNNGHNSRT CPNRGGGGGG  60
GGGVKLFGVR LTDGSIIKKS ASMGNLMTLH HHCSSPSSSF VAAAGDNPGS PDPVGYLSDD  120
PAHASSFANR RGERKKGIVI AFHGMQPKKM NNQHFLNFLS HFNFKLGTFS FFLVVKVKKV  180
TKLRILLGVP WTEEEHRMFL VGLQKLGKGD WRGISRNFVV SRTPTQVASH AQKYFIRQSN  240
ATRRKRRSSL FDMAPDMPTD PPSVLEKQVL LLTSENSQSP NVKSQPSLNL SLKSEVDPME  300
IASEENVKEN NVANGLKPKA AEYFPTYVPV RFSIWPSLEA SFQESNGVET SHHEVVKPIP  360
VVPKNPVNVD ALVGMSNLSI GNTQMILERE PSPLSLKLLG EPSRQSTFHA NTHAPVGRTD  420
LSSGKNNPIQ AV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169880.10.0PREDICTED: uncharacterized protein LOC107612693
TrEMBLG7II011e-160G7II01_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA13G43120.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.14e-82MYB_related family protein